Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339482.1 | 5prime_partial | 179 | 1-540(+) |
Amino Acid sequence : | |||
APVLVPNSARGTNPSHWFSSAAKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGAKKRKKKTYTKPKKIKHKKKK VKLPLLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYNKAGGD* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 14,501.906 | ||
Theoretical pI: | 5.527 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 46.672 | ||
aromaticity | 0.023 | ||
GRAVY | 0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.427 | ||
turn | 0.160 | ||
sheet | 0.412 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339482.1 | complete | 131 | 486-91(-) |
Amino Acid sequence : | |||
MPIKVVRHESSSSALRVRALLPQPLHLPRVIHLVELQQRKLHLLLLVLDLLRLGVGLLLTFLRATAEAEDEVERRLLLDVVVGEGAAVLELLSGEDEALLVRRNAFLVLDLSLDVVDGVG GFDLQGDRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 131 | ||
Molecular weight: | 14,501.906 | ||
Theoretical pI: | 5.527 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 46.672 | ||
aromaticity | 0.023 | ||
GRAVY | 0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.427 | ||
turn | 0.160 | ||
sheet | 0.412 |