Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339491.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
APVPFARDRIVEAHYWAIGTLEPYQYRYQRSLIAKIIALTTVVDDVYDVYGTLDELELFTDAIRRWDIESINQLPNYMQLCYLAIYNFVCELAYDIFRDKGFNSLPYLHKSWLDLVEAYF VEAKWFHDGYTPTLEEYLNNSKITITCPAILSEIYFTFANPINKTEVESIYKYHDILYLSGMLLRLPDDLGTTTFEMKRGDVAKAIQCYMKEHNASEEEAREHIRFLMREAWKKMNTVAT ADDCLFVSDFVV | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 29,585.451 | ||
Theoretical pI: | 4.836 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55810 56060 | ||
Instability index: | 41.450 | ||
aromaticity | 0.147 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.143 | ||
sheet | 0.282 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339491.1 | internal | 252 | 1-756(+) |
Amino Acid sequence : | |||
APVPFARDRIVEAHYWAIGTLEPYQYRYQRSLIAKIIALTTVVDDVYDVYGTLDELELFTDAIRRWDIESINQLPNYMQLCYLAIYNFVCELAYDIFRDKGFNSLPYLHKSWLDLVEAYF VEAKWFHDGYTPTLEEYLNNSKITITCPAILSEIYFTFANPINKTEVESIYKYHDILYLSGMLLRLPDDLGTTTFEMKRGDVAKAIQCYMKEHNASEEEAREHIRFLMREAWKKMNTVAT ADDCLFVSDFVV | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 29,585.451 | ||
Theoretical pI: | 4.836 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 55810 56060 | ||
Instability index: | 41.450 | ||
aromaticity | 0.147 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.143 | ||
sheet | 0.282 |