Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339494.1 | 3prime_partial | 129 | 351-737(+) |
Amino Acid sequence : | |||
MNKYNATWYTAVPTIHQIVLDRHLSKPEPVYPKLRFIRSCSASLAPAIMARLEEAFGAPVLEAYAMTEATHLMASNPLPEDGPHKAGSVGKPVGQEMAILDENGVVQGPNANGEVCIRGP NVTKGYKNN | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,941.821 | ||
Theoretical pI: | 6.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 39.659 | ||
aromaticity | 0.062 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.287 | ||
sheet | 0.295 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339494.1 | 3prime_partial | 129 | 351-737(+) |
Amino Acid sequence : | |||
MNKYNATWYTAVPTIHQIVLDRHLSKPEPVYPKLRFIRSCSASLAPAIMARLEEAFGAPVLEAYAMTEATHLMASNPLPEDGPHKAGSVGKPVGQEMAILDENGVVQGPNANGEVCIRGP NVTKGYKNN | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,941.821 | ||
Theoretical pI: | 6.899 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 39.659 | ||
aromaticity | 0.062 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.287 | ||
sheet | 0.295 |