Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339507.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
HQYTLSWTLVLHFSPSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELGAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWAETGAEYIVES TGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVG KVLPA | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 12,734.322 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 32.446 | ||
aromaticity | 0.079 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.325 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339507.1 | complete | 119 | 576-217(-) |
Amino Acid sequence : | |||
MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAALSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWP* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,734.322 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 32.446 | ||
aromaticity | 0.079 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.325 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339507.1 | complete | 114 | 400-56(-) |
Amino Acid sequence : | |||
MGCSLIFVSENTSGLHNVFSTSLSPWNLFWVSDAKNSHRFFTKEKGFLILNLELMVLPLAMNTVILEHIGHVISSDERIVDSTKLNVVSLKSNPSNETANSSESINSDLNLRHF* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,734.322 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 32.446 | ||
aromaticity | 0.079 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.325 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339507.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
HQYTLSWTLVLHFSPSLSLEMTKIKIGINGFGRIGRLVARVALQRDDVELGAVNDPFITTDYMTYMFKYDSVHGQWKHHELKVKDEKTLLFGEKSVTVFGIRNPEEIPWAETGAEYIVES TGVFTDKDKAAAHLKGGAKKVIISAPSKDAPMFVVGVNEKTYTPDLNIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSAKDWRGGRAASFNIIPSSTGAAKAVG KVLPA | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 12,734.322 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 32.446 | ||
aromaticity | 0.079 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.325 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339507.1 | complete | 119 | 576-217(-) |
Amino Acid sequence : | |||
MPNRSLITFANGARQFVVQLALDTMLRSGVYVFSLTPTTNIGASLLGAEIMTFLAPPFKWAAALSLSVKTPVDSTMYSAPVSAHGISSGFLMPKTVTDFSPKRRVFSSLTLSSWCFHWP* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 12,734.322 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 32.446 | ||
aromaticity | 0.079 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.325 | ||
sheet | 0.246 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339507.1 | complete | 114 | 400-56(-) |
Amino Acid sequence : | |||
MGCSLIFVSENTSGLHNVFSTSLSPWNLFWVSDAKNSHRFFTKEKGFLILNLELMVLPLAMNTVILEHIGHVISSDERIVDSTKLNVVSLKSNPSNETANSSESINSDLNLRHF* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,734.322 | ||
Theoretical pI: | 5.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
Instability index: | 32.446 | ||
aromaticity | 0.079 | ||
GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.325 | ||
sheet | 0.246 |