Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339509.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
TSSTKKIQKNPHRKIMSWQVYVDDHLLCEIEGNHLSAAAIIGLDGAVWAKSSTFPQFKPSEIDAILNDFNEPGSLAPTGLHLGGSKYMVIQGEPGVVIRGKKGPGGITIKKTNQALLIGI YDEPMTPGQCNLVVERLGDYLVEQGY* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 15,832.981 | ||
Theoretical pI: | 6.377 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 25.448 | ||
aromaticity | 0.068 | ||
GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
Helix | 0.308 | ||
turn | 0.281 | ||
sheet | 0.219 |