| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339509.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
| TSSTKKIQKNPHRKIMSWQVYVDDHLLCEIEGNHLSAAAIIGLDGAVWAKSSTFPQFKPSEIDAILNDFNEPGSLAPTGLHLGGSKYMVIQGEPGVVIRGKKGPGGITIKKTNQALLIGI YDEPMTPGQCNLVVERLGDYLVEQGY* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 15,832.981 | ||
| Theoretical pI: | 6.377 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 25.448 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.203 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.281 | ||
| sheet | 0.219 | ||