| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339510.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TIIVQLCGSCSKMDKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAV FLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIE KNPPDEVKEI | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 27,123.474 | ||
| Theoretical pI: | 7.600 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 37.857 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.244 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339510.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TIIVQLCGSCSKMDKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAV FLSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIE KNPPDEVKEI | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 27,123.474 | ||
| Theoretical pI: | 7.600 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 37.857 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.220 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.244 | ||
| sheet | 0.292 | ||