Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339521.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
APVDSFLFTSESVNDGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEI GAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEEGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRF VIGGPHGDAGLTGRKIIIDTYGGWGAH | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 12,660.246 | ||
Theoretical pI: | 4.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 37.187 | ||
aromaticity | 0.062 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339521.1 | complete | 113 | 801-460(-) |
Amino Acid sequence : | |||
MSTPATICVDDDLPTSETGISMWTTNHETPRWVKVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLIVLRGDEDCVNSHRNHGTFLVFVLDGDLGLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,660.246 | ||
Theoretical pI: | 4.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 37.187 | ||
aromaticity | 0.062 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339521.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
APVDSFLFTSESVNDGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKANVNYEKIVRDTCRGIGFISPDVGLDADNCKVLVNIEQQSPDIAQGVHGHLSKKPEEI GAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNEEGAMVPVRVHTVLISTQHDETVTNDQIAADLKEHVIKPVIPAQYLDEKTIFHLNPSGRF VIGGPHGDAGLTGRKIIIDTYGGWGAH | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 12,660.246 | ||
Theoretical pI: | 4.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 37.187 | ||
aromaticity | 0.062 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339521.1 | complete | 113 | 801-460(-) |
Amino Acid sequence : | |||
MSTPATICVDDDLPTSETGISMWTTNHETPRWVKVEDCLLIEILSRNHRLDDVLFQVSCNLVIRDSLIVLRGDEDCVNSHRNHGTFLVFVLDGDLGLTIGSQPWASLVLPHFS* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,660.246 | ||
Theoretical pI: | 4.648 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
Instability index: | 37.187 | ||
aromaticity | 0.062 | ||
GRAVY | 0.075 | ||
Secondary Structure Fraction | |||
Helix | 0.354 | ||
turn | 0.230 | ||
sheet | 0.212 |