| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339525.1 | 3prime_partial | 197 | 191-781(+) |
Amino Acid sequence : | |||
| MDVLAEMLSALDPGNKEGLKQEVIVDLVEQCRTYKQRVVHLVNSTSDESLLCQGLALNDDLQRVLAKHEAFASGTAPPPLEKPNAEPTKALVPVDAPLIDTGDTKQSDKGSSSSTSLATQ LSVPPPMSNGQVTTPIKADPKIDLLSGDDLNALALVPVGQPQPASPVASQNNALALVDMFSDSSNNQPLNPAAQPAY | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 20,671.032 | ||
| Theoretical pI: | 4.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.853 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.299 | ||
| sheet | 0.294 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339525.1 | 3prime_partial | 197 | 191-781(+) |
Amino Acid sequence : | |||
| MDVLAEMLSALDPGNKEGLKQEVIVDLVEQCRTYKQRVVHLVNSTSDESLLCQGLALNDDLQRVLAKHEAFASGTAPPPLEKPNAEPTKALVPVDAPLIDTGDTKQSDKGSSSSTSLATQ LSVPPPMSNGQVTTPIKADPKIDLLSGDDLNALALVPVGQPQPASPVASQNNALALVDMFSDSSNNQPLNPAAQPAY | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 20,671.032 | ||
| Theoretical pI: | 4.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 39.853 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.299 | ||
| sheet | 0.294 | ||