| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | internal | 230 | 692-3(-) |
Amino Acid sequence : | |||
| PKFRRRFRHIQNVVHHLKQQPYTARKSPQFLNFLLVRSSHNCPQNHRRLHQRRRLQAVDQLQMIESHRRHPLRAHIHHLPPGQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHG VAGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHCLDHLDGAGRWHGRGFLAANQLAGRDAEDRPHSLAAGEKGIPHGLVDLQWLLQLDCCFQGSVHGIRLLHHYTG | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| TRIMVEKANSVNRALEAAIQLKEPLEIHESMRYSLLAGGKRVRPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHV AAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVCAEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGANEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAEFG | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | 5prime_partial | 199 | 2-601(+) |
Amino Acid sequence : | |||
| HPYNGGEGEFREQSPGSSNPAEGAIGDPRVHEVFPSRRRQESAADPLHHGLRAGWRRGIHGHASGLRRRDDPDNVPDARRPALHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTR GRGDEGRGAGESGEGGAGAGEFDRVGGAVRGAGGGCVRGGDGGGGTRSSGVDPPPEDGGAGAGVGGSGGSCGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | 5prime_partial | 181 | 690-145(-) |
Amino Acid sequence : | |||
| QIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQLPPEPPTPAPAPPSSGGGSTPDDRVPPPPSPPRTHPPPAPRTAPPTRSNSPAPAPPSPLSPAPRPSSPRPRVRTRTTAWR RRPAPPRSRRTPCGWWASRGGGRRCPCRAGRRASGTLSGSSRRRRPLAWPWIPRRQPARRP* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | 3prime_partial | 112 | 337-2(-) |
Amino Acid sequence : | |||
| MASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIRDIVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISNGSFSWIAASRALFTEFAFSTIIRV | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | internal | 230 | 692-3(-) |
Amino Acid sequence : | |||
| PKFRRRFRHIQNVVHHLKQQPYTARKSPQFLNFLLVRSSHNCPQNHRRLHQRRRLQAVDQLQMIESHRRHPLRAHIHHLPPGQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHG VAGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHCLDHLDGAGRWHGRGFLAANQLAGRDAEDRPHSLAAGEKGIPHGLVDLQWLLQLDCCFQGSVHGIRLLHHYTG | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| TRIMVEKANSVNRALEAAIQLKEPLEIHESMRYSLLAGGKRVRPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHV AAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVCAEGMAAVGLDHLELIHRLKTAALVQASVVLGAVVGGANEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAEFG | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | 5prime_partial | 199 | 2-601(+) |
Amino Acid sequence : | |||
| HPYNGGEGEFREQSPGSSNPAEGAIGDPRVHEVFPSRRRQESAADPLHHGLRAGWRRGIHGHASGLRRRDDPDNVPDARRPALHGQRRPPPREAHQPQGVRRERGGAGRRRHAVVRVRTR GRGDEGRGAGESGEGGAGAGEFDRVGGAVRGAGGGCVRGGDGGGGTRSSGVDPPPEDGGAGAGVGGSGGSCGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | 5prime_partial | 181 | 690-145(-) |
Amino Acid sequence : | |||
| QIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQLPPEPPTPAPAPPSSGGGSTPDDRVPPPPSPPRTHPPPAPRTAPPTRSNSPAPAPPSPLSPAPRPSSPRPRVRTRTTAWR RRPAPPRSRRTPCGWWASRGGGRRCPCRAGRRASGTLSGSSRRRRPLAWPWIPRRQPARRP* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339536.1 | 3prime_partial | 112 | 337-2(-) |
Amino Acid sequence : | |||
| MASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIRDIVWIISTAQAAGMAVDSSPPTSSQAVMQRIGRTLLPPARREYLMDSWISNGSFSWIAASRALFTEFAFSTIIRV | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,258.975 | ||
| Theoretical pI: | 11.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 72.017 | ||
| aromaticity | 0.098 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.295 | ||
| sheet | 0.250 | ||