| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339537.1 | internal | 109 | 328-2(-) |
Amino Acid sequence : | |||
| AVPPMKCTVFDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILFKFIIHDWADEEGLKILTRCKDSVGIGGKAIIIDVVVGVNHDIAQVLEDQFHFDSAMRRYFNANER | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,079.717 | ||
| Theoretical pI: | 4.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 33.285 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.193 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339537.1 | internal | 109 | 328-2(-) |
Amino Acid sequence : | |||
| AVPPMKCTVFDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILFKFIIHDWADEEGLKILTRCKDSVGIGGKAIIIDVVVGVNHDIAQVLEDQFHFDSAMRRYFNANER | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,079.717 | ||
| Theoretical pI: | 4.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 33.285 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.349 | ||
| turn | 0.193 | ||
| sheet | 0.220 | ||