Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339543.1 | 5prime_partial | 231 | 737-42(-) |
Amino Acid sequence : | |||
NRLDHMLLQIRSNLIICHSLVMLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYALSNIRAL LLNIHQNLTVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKELQI* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 23,941.716 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 33.520 | ||
aromaticity | 0.046 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.183 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339543.1 | 3prime_partial | 218 | 84-737(+) |
Amino Acid sequence : | |||
METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDQTVTNDEIAADLKEHVIKPV | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 23,941.716 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 33.520 | ||
aromaticity | 0.046 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.183 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339543.1 | 5prime_partial | 231 | 737-42(-) |
Amino Acid sequence : | |||
NRLDHMLLQIRSNLIICHSLVMLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYALSNIRAL LLNIHQNLTVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKELQI* | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 23,941.716 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 33.520 | ||
aromaticity | 0.046 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.183 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339543.1 | 3prime_partial | 218 | 84-737(+) |
Amino Acid sequence : | |||
METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDQTVTNDEIAADLKEHVIKPV | |||
Physicochemical properties | |||
Number of amino acids: | 218 | ||
Molecular weight: | 23,941.716 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 33.520 | ||
aromaticity | 0.046 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.183 | ||
sheet | 0.243 |