Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339547.1 | complete | 213 | 31-672(+) |
Amino Acid sequence : | |||
MAKPTPFLILSLFLFITTSHALVQDFCVADLSLPAGPAGYSCKDAANVTVADFTFSGLRMGGNTTNIIGAAVTPAFDAQYPGLNGLGLSIARLDLAPGGVVPFHTHPAASELLLVVQGTI VTGFVSSFANKVYLKKLVKGDLMVFPQGLLHFQINGGGKTAVAFASFSSPNPGLQITDFALFANDLPSALVEKTTFLDDAQVKKLKGVLGGTG* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 19,005.860 | ||
Theoretical pI: | 9.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 48.308 | ||
aromaticity | 0.084 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.335 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339547.1 | 5prime_partial | 200 | 696-94(-) |
Amino Acid sequence : | |||
RVRNEENKSSSATKHTLKFLHLRIIQERRFLHQRRRQIIRKQREVRYLQARIGAAEAGEGHRRLPAAVDLEMQQPLREHHQVPLHQLLQVHLVRERRHESRDDGPLHHQEELRRRRVGVE RHHTAGGQVQPRDRQPQPVKPWVLGVEGRGDGGADDVGGVAAHAEAGEGEVGDGDVGSVFAGVAGGARGEGEVCHAEVLD* | |||
Physicochemical properties | |||
Number of amino acids: | 200 | ||
Molecular weight: | 19,005.860 | ||
Theoretical pI: | 9.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 48.308 | ||
aromaticity | 0.084 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.335 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339547.1 | complete | 179 | 686-147(-) |
Amino Acid sequence : | |||
MKKINHPVPPSTPLSFFTCASSKNVVFSTNADGKSFANSAKSVICKPGLGLLKLAKATAVFPPPLIWKCSSPCGNTIRSPFTSFFRYTLFANDDTNPVTMVPCTTRRSSDAAGWVWNGTT PPGAKSSRAIDSPSPLSPGYWASKAGVTAAPMMLVVLPPMRRPEKVKSATVTLAASLQE* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,005.860 | ||
Theoretical pI: | 9.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
Instability index: | 48.308 | ||
aromaticity | 0.084 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.251 | ||
turn | 0.335 | ||
sheet | 0.212 |