Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339549.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
APFIVPNSARGIRLILKVRNFNHHALSHPSYGNSSSPIQNPNPPCIPKFKRKHLASMATIYCCRECGANLNLQPGDLFPPDFYFEAGNKDSLSFAAVDSSKFRFEKEDKIRPFFETVNYW GIQRKRTKIMCNSCGKVLGYIYDDGPPLTTGIGQLGFGPSQAVPRNPRYRFKNKALTITSQT* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,446.227 | ||
Theoretical pI: | 9.722 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16305 | ||
Instability index: | 35.903 | ||
aromaticity | 0.115 | ||
GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
Helix | 0.280 | ||
turn | 0.313 | ||
sheet | 0.165 |