| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339549.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
| APFIVPNSARGIRLILKVRNFNHHALSHPSYGNSSSPIQNPNPPCIPKFKRKHLASMATIYCCRECGANLNLQPGDLFPPDFYFEAGNKDSLSFAAVDSSKFRFEKEDKIRPFFETVNYW GIQRKRTKIMCNSCGKVLGYIYDDGPPLTTGIGQLGFGPSQAVPRNPRYRFKNKALTITSQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 20,446.227 | ||
| Theoretical pI: | 9.722 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16305 | ||
| Instability index: | 35.903 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
| Helix | 0.280 | ||
| turn | 0.313 | ||
| sheet | 0.165 | ||