| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339555.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| APVRASITTAFASRRLFHKLKRSPFDDVVESKNLENRTLSSIHQVLESWIRVAKQLLARISDEIDSTLYVRASSDCWMLEKVWSVINQIEDLHLLMDPDDFLRLKNQLMIKASSDSELFC FLSRQLVEITKSSKDLKHKVPAVLEVEVDPTGGPRIQNAAMELYRRKEEFAKIHLLQAMQSVEAAVKKFYFSYKQLLAVVMGSLEAKANVESGDLLSQIFLEPTYFPSLDAAKTFLG | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 11,419.619 | ||
| Theoretical pI: | 10.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 109.577 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339555.1 | 5prime_partial | 108 | 712-386(-) |
Amino Acid sequence : | |||
| PRETSWRRPSLGNTSAQEKSGSIDHPIQHSPSPPSSPSPPPAAACKRSKTSSPPLPPTASPVAGGFSRTPPFSGKVPWRRSVSSVHQSDQPPLPKPPAPYASDPWKIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,419.619 | ||
| Theoretical pI: | 10.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 109.577 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339555.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| APVRASITTAFASRRLFHKLKRSPFDDVVESKNLENRTLSSIHQVLESWIRVAKQLLARISDEIDSTLYVRASSDCWMLEKVWSVINQIEDLHLLMDPDDFLRLKNQLMIKASSDSELFC FLSRQLVEITKSSKDLKHKVPAVLEVEVDPTGGPRIQNAAMELYRRKEEFAKIHLLQAMQSVEAAVKKFYFSYKQLLAVVMGSLEAKANVESGDLLSQIFLEPTYFPSLDAAKTFLG | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 11,419.619 | ||
| Theoretical pI: | 10.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 109.577 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339555.1 | 5prime_partial | 108 | 712-386(-) |
Amino Acid sequence : | |||
| PRETSWRRPSLGNTSAQEKSGSIDHPIQHSPSPPSSPSPPPAAACKRSKTSSPPLPPTASPVAGGFSRTPPFSGKVPWRRSVSSVHQSDQPPLPKPPAPYASDPWKIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,419.619 | ||
| Theoretical pI: | 10.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 109.577 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.948 | ||
Secondary Structure Fraction | |||
| Helix | 0.148 | ||
| turn | 0.491 | ||
| sheet | 0.120 | ||