Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339561.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
KTMGADSKGAQVYHGPKICKEKLENMLDEFSVPRCLFHNLGDCEEFAFNRATGFYWLKKKSKTERKIEKVGTVYYEKELSAFIQHRRLTKITGMKAKELFLTLAVSEIVVGVPTDDKVKF VSSTGIYRAIPIATLEPTMGESSGK* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,329.797 | ||
Theoretical pI: | 9.203 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 21.796 | ||
aromaticity | 0.097 | ||
GRAVY | -0.334 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.193 | ||
sheet | 0.255 |