Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339562.1 | 5prime_partial | 205 | 3-620(+) |
Amino Acid sequence : | |||
TNLHLGDGVFNFVVDIPKESSAKMEVATDEQHTPIKQDTKKGKLRYYPYNIHWNYGLLPQTWEDPTFANTEVEGAFGDNDPVDVVEIGESRGKIGQVLKVKPLAALAMIDEGELDWKIVA ISLDDPRALLVNDVDDVEKHFPGTLTAIRDWFRDYKIPDGKPANRFALGNKPANKDYALKIITETNESWAKLVKRSIAAGELSLV* | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 22,919.664 | ||
Theoretical pI: | 5.064 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36440 | ||
Instability index: | 21.408 | ||
aromaticity | 0.088 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.215 | ||
sheet | 0.249 |