Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339573.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
APLFISSHTKNKNMKPSIFILFSLFFTYANAATILVRNNCPYTVWAAGVPAGGGKRLDRGQTWTINAPPGTKQARVWGRTGCNFDASGKGKCQTGDCNGLLVCKSFGVPPNTLAEYALNQ FANKDFFDISLVDGFNVPMEFSPTSNGCTRGITCKAEINQQCPNELKAPGGCNNPCTVFKTDQYCCNSGNCGPTTFSRFFKERCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 12,159.947 | ||
Theoretical pI: | 11.655 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 66.606 | ||
aromaticity | 0.082 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.318 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339573.1 | complete | 110 | 455-123(-) |
Amino Acid sequence : | |||
MPRVHPLEVGLNSIGTLNPSTREISKKSLFANWFRAYSANVFGGTPKDLHTRRPLQSPVWHFPLPDASKLHPVRPQTRACLVPGGAFIVHVWPRSRRLPPPAGTPAAQTV* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,159.947 | ||
Theoretical pI: | 11.655 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 66.606 | ||
aromaticity | 0.082 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.318 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339573.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
APLFISSHTKNKNMKPSIFILFSLFFTYANAATILVRNNCPYTVWAAGVPAGGGKRLDRGQTWTINAPPGTKQARVWGRTGCNFDASGKGKCQTGDCNGLLVCKSFGVPPNTLAEYALNQ FANKDFFDISLVDGFNVPMEFSPTSNGCTRGITCKAEINQQCPNELKAPGGCNNPCTVFKTDQYCCNSGNCGPTTFSRFFKERCPDAYSYPKDDQTSTFTCPAGTNYRVVFCP* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 12,159.947 | ||
Theoretical pI: | 11.655 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 66.606 | ||
aromaticity | 0.082 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.318 | ||
sheet | 0.200 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339573.1 | complete | 110 | 455-123(-) |
Amino Acid sequence : | |||
MPRVHPLEVGLNSIGTLNPSTREISKKSLFANWFRAYSANVFGGTPKDLHTRRPLQSPVWHFPLPDASKLHPVRPQTRACLVPGGAFIVHVWPRSRRLPPPAGTPAAQTV* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 12,159.947 | ||
Theoretical pI: | 11.655 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 66.606 | ||
aromaticity | 0.082 | ||
GRAVY | -0.317 | ||
Secondary Structure Fraction | |||
Helix | 0.282 | ||
turn | 0.318 | ||
sheet | 0.200 |