Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339575.1 | 5prime_partial | 156 | 1-471(+) |
Amino Acid sequence : | |||
RELWPFQYALSRIRNAARMLLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFS LTSPFGGGRPGRVKRKNQKSAAKKAAGGDGDEEDEE* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 12,279.375 | ||
Theoretical pI: | 10.907 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
Instability index: | 70.683 | ||
aromaticity | 0.142 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.226 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339575.1 | complete | 106 | 485-165(-) |
Amino Acid sequence : | |||
MNTRVYSSSSSSPSPPAAFFAADFWFFRFTLPGRPPPKGLVREKSMCFWESTLTMKEATFTTCLPTLICLCRMSTLAWWIDLAMPVLKTRVWRRRSRKFSTVRAKT* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 12,279.375 | ||
Theoretical pI: | 10.907 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
Instability index: | 70.683 | ||
aromaticity | 0.142 | ||
GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
Helix | 0.292 | ||
turn | 0.226 | ||
sheet | 0.236 |