| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339575.1 | 5prime_partial | 156 | 1-471(+) |
Amino Acid sequence : | |||
| RELWPFQYALSRIRNAARMLLTLDEKDPRRIFEGEALLRRMNRYGLLDESQNKLDYVLALTVENFLERRLQTLVFKTGMAKSIHHARVLIRQRHIRVGRQVVNVASFMVRVDSQKHIDFS LTSPFGGGRPGRVKRKNQKSAAKKAAGGDGDEEDEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 12,279.375 | ||
| Theoretical pI: | 10.907 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 70.683 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.226 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339575.1 | complete | 106 | 485-165(-) |
Amino Acid sequence : | |||
| MNTRVYSSSSSSPSPPAAFFAADFWFFRFTLPGRPPPKGLVREKSMCFWESTLTMKEATFTTCLPTLICLCRMSTLAWWIDLAMPVLKTRVWRRRSRKFSTVRAKT* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,279.375 | ||
| Theoretical pI: | 10.907 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 70.683 | ||
| aromaticity | 0.142 | ||
| GRAVY | -0.091 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.226 | ||
| sheet | 0.236 | ||