| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339583.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| HHCCFKMSNMFASAALISTNNTTVEDMRRSVTYHPSVWKDHFLDYASGITEVEMEQLEKQKERIKTLLAQTPDDSVLKIELIDAIQRLGVGYHFEKEINHSLRQIYDTFQISSKDNDIRV VALHFRLLRQHGYPVPSAVFKKFIDNQGRLEESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLETLASHSRRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLD FNIL | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 28,158.668 | ||
| Theoretical pI: | 5.494 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 40.227 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.382 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.189 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339583.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
| HHCCFKMSNMFASAALISTNNTTVEDMRRSVTYHPSVWKDHFLDYASGITEVEMEQLEKQKERIKTLLAQTPDDSVLKIELIDAIQRLGVGYHFEKEINHSLRQIYDTFQISSKDNDIRV VALHFRLLRQHGYPVPSAVFKKFIDNQGRLEESVMNNVEGMLSLYEASNYGMEGEDILDKALEISTSHLETLASHSRRINEALEMPISKTLVRLGARKFISIYEEDESRDEDLLKFAKLD FNIL | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 28,158.668 | ||
| Theoretical pI: | 5.494 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
| Instability index: | 40.227 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.382 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.189 | ||
| sheet | 0.291 | ||