| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339585.1 | 3prime_partial | 219 | 79-735(+) |
Amino Acid sequence : | |||
| MASTFAGLSSVGSLAAPGSRVLDDKVAISSGKLSSLASISSSSLGRRKNVALRKTRPFQVSAASKELYFNKDGSAIKRLQVGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA REVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTTKALVSELKAISKEVEDSELADVAAVSAGNNYE | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 22,516.429 | ||
| Theoretical pI: | 9.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 29.432 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.269 | ||
| sheet | 0.297 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339585.1 | 3prime_partial | 219 | 79-735(+) |
Amino Acid sequence : | |||
| MASTFAGLSSVGSLAAPGSRVLDDKVAISSGKLSSLASISSSSLGRRKNVALRKTRPFQVSAASKELYFNKDGSAIKRLQVGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVA REVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTTKALVSELKAISKEVEDSELADVAAVSAGNNYE | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 22,516.429 | ||
| Theoretical pI: | 9.369 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 29.432 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.269 | ||
| sheet | 0.297 | ||