| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339591.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
| TSDTKSNNLYLLLAPKKKKKTYNKIMSESVADMEDWSLQAIVRGSSGDFGKIVMDMDGPDLFQQLLDQDFTGFPDILEGSSTGSSDELEELYKPFYPSTTSFCLPDQAVLEFQEQNVVED KPSQDQSDQSSITSPVASAAAVYTPKYKKRSVDFYFLEVSAEELYL* | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,588.457 | ||
| Theoretical pI: | 4.296 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 52.289 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.247 | ||
| sheet | 0.247 | ||