Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339591.1 | 5prime_partial | 166 | 3-503(+) |
Amino Acid sequence : | |||
TSDTKSNNLYLLLAPKKKKKTYNKIMSESVADMEDWSLQAIVRGSSGDFGKIVMDMDGPDLFQQLLDQDFTGFPDILEGSSTGSSDELEELYKPFYPSTTSFCLPDQAVLEFQEQNVVED KPSQDQSDQSSITSPVASAAAVYTPKYKKRSVDFYFLEVSAEELYL* | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,588.457 | ||
Theoretical pI: | 4.296 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
Instability index: | 52.289 | ||
aromaticity | 0.108 | ||
GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.247 | ||
sheet | 0.247 |