Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339601.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
TRVLHSLCLHNSIKMALNLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAI HLVHAAAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGA | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 17,618.909 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 94.014 | ||
aromaticity | 0.013 | ||
GRAVY | -1.263 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.323 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339601.1 | 3prime_partial | 175 | 526-2(-) |
Amino Acid sequence : | |||
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERFRAILIELWRQRECSTRV | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 17,618.909 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 94.014 | ||
aromaticity | 0.013 | ||
GRAVY | -1.263 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.323 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339601.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
HACTTLPLPPQFNQNGSKSLSQHQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRH TPRACGGPRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,618.909 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 94.014 | ||
aromaticity | 0.013 | ||
GRAVY | -1.263 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.323 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339601.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
TRVLHSLCLHNSIKMALNLSLNTKQSPPIKAISTFRRPPPPCMATAVAVAGNQSYWDTIRDDINSYLKKAIPIRSPETVFEPMHHLTLSAPSTTASALCVAACELIGGHRSQAIAAASAI HLVHAAAHAHEHLPLTDGSRPECKPDIQHKFNPNIELLTGDGIAPFGFELLARSIDDPAQDQNPARILRVIIEISQAAGSQGLIDGLYKEAEIVDPLSRFGFVEYVCRKKYGEIHGCGA | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 17,618.909 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 94.014 | ||
aromaticity | 0.013 | ||
GRAVY | -1.263 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.323 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339601.1 | 3prime_partial | 175 | 526-2(-) |
Amino Acid sequence : | |||
MDRARSSNPNGAIPSPVRSSMLGLNLCWISGLHSGLEPSVRGRCSWAWAAACTRCMAEAAAMAWLRWPPMSSQAATQRAEAVVEGAERVRWCMGSNTVSGDLIGMAFLRYELMSSRMVSQ YDWFPATATAVAMHGGGGRRKVDIALMGGLCLVLRERFRAILIELWRQRECSTRV | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 17,618.909 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 94.014 | ||
aromaticity | 0.013 | ||
GRAVY | -1.263 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.323 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339601.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
HACTTLPLPPQFNQNGSKSLSQHQTKSPHQSDINLPPSTAAVHGHRRRRRREPIILGHHPGRHQLVSQESHPNKIAGNGIRAHAPPHPLRPLHHRLRPLCGGLRAHRRPPEPSHRRRLRH TPRACGGPRPRAPPPNRRLQARMQARYPTQVQPQH* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,618.909 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 94.014 | ||
aromaticity | 0.013 | ||
GRAVY | -1.263 | ||
Secondary Structure Fraction | |||
Helix | 0.148 | ||
turn | 0.323 | ||
sheet | 0.181 |