| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339604.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TRFPITATTLLVILILATLDFTGAQTGVCYGRNGNGLPSPADVVALCNRNNIRRMRIYDPHQPTLQALRGSNIELILGVPNPDLQNIASSQANANAWVQNNVRNYGNVKFRYIAVGNEVS PLNGNAQYVPFVINAMRNIQNAISGAGLGNQIKVSTAIETELTTDTYPPSRGKFKDNVRGYVDPIIRFLVANRSPLLVNIYPYFAIANNQAIKLDYALFTSPGVVVNDNGREYRNLFDAL LNATYSALEK | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 27,445.893 | ||
| Theoretical pI: | 9.389 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23505 | ||
| Instability index: | 40.322 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.292 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339604.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TRFPITATTLLVILILATLDFTGAQTGVCYGRNGNGLPSPADVVALCNRNNIRRMRIYDPHQPTLQALRGSNIELILGVPNPDLQNIASSQANANAWVQNNVRNYGNVKFRYIAVGNEVS PLNGNAQYVPFVINAMRNIQNAISGAGLGNQIKVSTAIETELTTDTYPPSRGKFKDNVRGYVDPIIRFLVANRSPLLVNIYPYFAIANNQAIKLDYALFTSPGVVVNDNGREYRNLFDAL LNATYSALEK | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 27,445.893 | ||
| Theoretical pI: | 9.389 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23505 | ||
| Instability index: | 40.322 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.292 | ||
| sheet | 0.224 | ||