Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339606.1 | 5prime_partial | 179 | 601-62(-) |
Amino Acid sequence : | |||
VAACENMISGTGMRLGDIITASNGKTIEVTNTDAEGRLTLADALVYACNQGVEKIVDLATLNGACVVALGPYIGGVFPPSDALAKEVIGASEGGGEKLWRMPLEESYWESMKSGVVDMLN MGGRQGGSINAALLLKQFVDEKVQWIHIDMDGPVYSDKKKGATGLGIYTLVEWGLKNYC* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,005.605 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
Instability index: | 23.734 | ||
aromaticity | 0.067 | ||
GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.257 | ||
sheet | 0.291 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339606.1 | 5prime_partial | 179 | 601-62(-) |
Amino Acid sequence : | |||
VAACENMISGTGMRLGDIITASNGKTIEVTNTDAEGRLTLADALVYACNQGVEKIVDLATLNGACVVALGPYIGGVFPPSDALAKEVIGASEGGGEKLWRMPLEESYWESMKSGVVDMLN MGGRQGGSINAALLLKQFVDEKVQWIHIDMDGPVYSDKKKGATGLGIYTLVEWGLKNYC* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 19,005.605 | ||
Theoretical pI: | 4.716 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
Instability index: | 23.734 | ||
aromaticity | 0.067 | ||
GRAVY | 0.051 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.257 | ||
sheet | 0.291 |