| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339621.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
| APVAYDYAMLGFASYGAYWRQLRKIVSLELLSNRRLELQNHVSMSETGQFVKELYKLWEKKKSDGSGTGRFTTEVGEGVVVDMKRWLGQLNMNVVMRMVAGKRFGSGDNAEETRRCRRVM RDFFYLAGFFVPADALPYLGWLDLGGHEKRMKKAAKELDDVVGEWLAEHREREFSGEGKAEDFMDVMISVVKGADLQCEFDVDTIIKATCGTLIAGGTDTTAVVFVWGTFPPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 23,879.693 | ||
| Theoretical pI: | 10.512 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 72.729 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.236 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339621.1 | 5prime_partial | 208 | 717-91(-) |
Amino Acid sequence : | |||
| EHDCGLSRRESAPYKHHCSSVSTTSDQSPTSSFNNGINIKFALKICTFNHRDHHVHKVLRLTLAGKLPFPVLRQPLSDHIIQLLGSFLHPLLMPSQIQPPQIRQRVRRHKKPRQIEEIPH HPPAPPRLLRVVSASKSLASHHPHHHIHVQLTKPPLHIHHHSLTYFCCKPACARPITFLLLPQLIKLLHKLTSFRHAHVILELQSPIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,879.693 | ||
| Theoretical pI: | 10.512 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 72.729 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.236 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339621.1 | 5prime_partial | 233 | 1-702(+) |
Amino Acid sequence : | |||
| APVAYDYAMLGFASYGAYWRQLRKIVSLELLSNRRLELQNHVSMSETGQFVKELYKLWEKKKSDGSGTGRFTTEVGEGVVVDMKRWLGQLNMNVVMRMVAGKRFGSGDNAEETRRCRRVM RDFFYLAGFFVPADALPYLGWLDLGGHEKRMKKAAKELDDVVGEWLAEHREREFSGEGKAEDFMDVMISVVKGADLQCEFDVDTIIKATCGTLIAGGTDTTAVVFVWGTFPPT* | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 23,879.693 | ||
| Theoretical pI: | 10.512 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 72.729 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.236 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339621.1 | 5prime_partial | 208 | 717-91(-) |
Amino Acid sequence : | |||
| EHDCGLSRRESAPYKHHCSSVSTTSDQSPTSSFNNGINIKFALKICTFNHRDHHVHKVLRLTLAGKLPFPVLRQPLSDHIIQLLGSFLHPLLMPSQIQPPQIRQRVRRHKKPRQIEEIPH HPPAPPRLLRVVSASKSLASHHPHHHIHVQLTKPPLHIHHHSLTYFCCKPACARPITFLLLPQLIKLLHKLTSFRHAHVILELQSPIR* | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,879.693 | ||
| Theoretical pI: | 10.512 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 72.729 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.346 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.236 | ||
| sheet | 0.207 | ||