Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339627.1 | internal | 157 | 473-3(-) |
Amino Acid sequence : | |||
IIDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLITNLGKEHEILITVEEGSIGGFSAHVSHFLSLNEL LDGNLKWRPMVLPDRYIEHGGHPDQIEEAXLNSKHIP | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 16,797.953 | ||
Theoretical pI: | 5.772 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 26.131 | ||
aromaticity | 0.045 | ||
GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.295 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339627.1 | internal | 157 | 473-3(-) |
Amino Acid sequence : | |||
IIDDRPSCVRYPRGNGVGAPLPPNNKGTPLEIGKGRILKEGNRVAILGFGTIVQNCLAAAGVLEEHGISATVADARFCKPLDGDLITNLGKEHEILITVEEGSIGGFSAHVSHFLSLNEL LDGNLKWRPMVLPDRYIEHGGHPDQIEEAXLNSKHIP | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 16,797.953 | ||
Theoretical pI: | 5.772 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 26.131 | ||
aromaticity | 0.045 | ||
GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.295 | ||
sheet | 0.256 |