Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339642.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
TRTSSRDEVPSNKNTFGHERFARMPDVETDTNPIDRTVAHLLFHRPLEFSGKPADAPDSPLSANLPYEKKANPSESLTKGYAAESFRNTQITSPQGSKTTGIFSEGNQSKNSPAFVTSDN ASNNENTDGVQAKVEASS* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 14,944.965 | ||
Theoretical pI: | 5.586 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 40.376 | ||
aromaticity | 0.065 | ||
GRAVY | -0.965 | ||
Secondary Structure Fraction | |||
Helix | 0.174 | ||
turn | 0.348 | ||
sheet | 0.210 |