Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339643.1 | complete | 125 | 168-545(+) |
Amino Acid sequence : | |||
MPQHFHVENPHQAGAIPPNAVVGDPKGIPLQQTIFRDTPAPFSCPYCGSSGVTSVKSKPSLAAFVCWMMPFMLGVCFLCPSMDCLWHKYHYCPSCNEKVADFEKSDICAVMDPPHYIQPS FALPA* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 13,759.898 | ||
Theoretical pI: | 6.254 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17460 | ||
Instability index: | 63.935 | ||
aromaticity | 0.112 | ||
GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
Helix | 0.272 | ||
turn | 0.288 | ||
sheet | 0.200 |