Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339647.1 | 5prime_partial | 188 | 1-567(+) |
Amino Acid sequence : | |||
APIALSLHPTDLKSSFPSGFDYLRKEKAKMDIEDLKKMEDEESSLMKTLKGATTGLVAGTFWGMVVATWHDVPRVERRVALPGLIRTFKMMGNHGATFAAIGGLYMGTEQLMQKQRMKRD YINGAVGGFVAGATVFGFKGRKISTAMSAGSAFAVTSAIIEVLGIEKRDTGKVNHVYTREKRPTVEAN* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 20,517.590 | ||
Theoretical pI: | 9.726 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 41.522 | ||
aromaticity | 0.080 | ||
GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.213 | ||
sheet | 0.282 |