| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339657.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
| FTYLGMVLVSITPSFPVASISQSAFYTMFNLFAGFLVPHPQIPKWWIWLYYLVPTSWSLNGILTSQFGDIEEKITVFGETKTVAAFLKDYFGYEHRLLPLVAVMLILYPIIFASIFALCI SKLNFQRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,728.259 | ||
| Theoretical pI: | 8.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32430 | ||
| Instability index: | 36.666 | ||
| aromaticity | 0.188 | ||
| GRAVY | 0.666 | ||
Secondary Structure Fraction | |||
| Helix | 0.477 | ||
| turn | 0.211 | ||
| sheet | 0.242 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339657.1 | 5prime_partial | 128 | 3-389(+) |
Amino Acid sequence : | |||
| FTYLGMVLVSITPSFPVASISQSAFYTMFNLFAGFLVPHPQIPKWWIWLYYLVPTSWSLNGILTSQFGDIEEKITVFGETKTVAAFLKDYFGYEHRLLPLVAVMLILYPIIFASIFALCI SKLNFQRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,728.259 | ||
| Theoretical pI: | 8.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32430 | ||
| Instability index: | 36.666 | ||
| aromaticity | 0.188 | ||
| GRAVY | 0.666 | ||
Secondary Structure Fraction | |||
| Helix | 0.477 | ||
| turn | 0.211 | ||
| sheet | 0.242 | ||