| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339662.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
| TSGESIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRLLPPDLRERVRRYDQYKWLETRGVDEESLVQTLPKDLRRDIKRHLCLALVKRVPLFEDMDERLLDA ICERLKPCLYTESSYIVREGDPVDEMIFLIRGRLESVTTDGGRSGFFNRSLLKEGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQVQHTFRFY SQ | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 28,219.111 | ||
| Theoretical pI: | 6.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 53.834 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.329 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.169 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339662.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
| TSGESIFSIALAIFGLILFALLIGNMQTYLQSLTIRLEEMRVKRRDSEQWMHHRLLPPDLRERVRRYDQYKWLETRGVDEESLVQTLPKDLRRDIKRHLCLALVKRVPLFEDMDERLLDA ICERLKPCLYTESSYIVREGDPVDEMIFLIRGRLESVTTDGGRSGFFNRSLLKEGDFCGEELLTWALDPKSGSNLPSSTRTVKALTEVEAFALTADELKFVASQFRRLHSRQVQHTFRFY SQ | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 28,219.111 | ||
| Theoretical pI: | 6.921 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
| Instability index: | 53.834 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.329 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.169 | ||
| sheet | 0.298 | ||