| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339677.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
| TRSPRVLRFGKNSILLASTAKTVKDVSPHDFVKAYAAHLKRSGKMELPEWTDIVKTGVLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGSKRNGSRPPHFGKSSGSVARHI LQQLQNMSIVEMEPRGGRRITSNGRRDLDQVAGRIAVVAP* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,775.315 | ||
| Theoretical pI: | 10.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 58.138 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.269 | ||
| sheet | 0.213 | ||