Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339677.1 | 5prime_partial | 160 | 2-484(+) |
Amino Acid sequence : | |||
TRSPRVLRFGKNSILLASTAKTVKDVSPHDFVKAYAAHLKRSGKMELPEWTDIVKTGVLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGSKRNGSRPPHFGKSSGSVARHI LQQLQNMSIVEMEPRGGRRITSNGRRDLDQVAGRIAVVAP* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 17,775.315 | ||
Theoretical pI: | 10.837 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 58.138 | ||
aromaticity | 0.075 | ||
GRAVY | -0.461 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.269 | ||
sheet | 0.213 |