| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339691.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| APVSISMQFISCVQLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERA LRIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATA S | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,350.951 | ||
| Theoretical pI: | 8.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
| Instability index: | 48.894 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.402 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.220 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339691.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
| APVSISMQFISCVQLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERA LRIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATA S | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 27,350.951 | ||
| Theoretical pI: | 8.816 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
| Instability index: | 48.894 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.402 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.220 | ||
| sheet | 0.228 | ||