| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | internal | 202 | 1-606(+) |
Amino Acid sequence : | |||
| KVKQVFLCLPIQFVGQFSGFLQPNQLWIRGFIRRQILPGRLPQFRRRFRHIQNVVHHLKQQPYTARKSPQFLNFLLARSSHNRPQNHRRLHQRRRLQAVDQLQMIESHGRHPLRADVHHL PPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVLVHAGQVVVHQGHGLDH | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | 3prime_partial | 202 | 606-1(-) |
Amino Acid sequence : | |||
| MIQTMSLMHDDLPCMDKDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHRLKTAALVQASVVLGA VVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHF | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | 5prime_partial | 129 | 604-215(-) |
Amino Acid sequence : | |||
| DPDHVLDARRPALHGQGRPPPREAHQPQGVRRERGGAGRGRHAVVRVRTRGRGDEGRGAGESGEGGAGAGEFDRVGGAVGGAGGGRQRGGDGGRGTRSSGVDPPPEDGGAGAGVGGSGGG CGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| SEAGVPLPPDSICRPILWISPAQSALDTWLYPPPNPSRPSSPIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQPPPEPPTPAPAPPSSGGGSTPDDRVPRPPSPPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | internal | 202 | 1-606(+) |
Amino Acid sequence : | |||
| KVKQVFLCLPIQFVGQFSGFLQPNQLWIRGFIRRQILPGRLPQFRRRFRHIQNVVHHLKQQPYTARKSPQFLNFLLARSSHNRPQNHRRLHQRRRLQAVDQLQMIESHGRHPLRADVHHL PPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVLVHAGQVVVHQGHGLDH | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | 3prime_partial | 202 | 606-1(-) |
Amino Acid sequence : | |||
| MIQTMSLMHDDLPCMDKDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLDHLELIHRLKTAALVQASVVLGA VVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHF | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | 5prime_partial | 129 | 604-215(-) |
Amino Acid sequence : | |||
| DPDHVLDARRPALHGQGRPPPREAHQPQGVRRERGGAGRGRHAVVRVRTRGRGDEGRGAGESGEGGAGAGEFDRVGGAVGGAGGGRQRGGDGGRGTRSSGVDPPPEDGGAGAGVGGSGGG CGRSERGGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339697.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| SEAGVPLPPDSICRPILWISPAQSALDTWLYPPPNPSRPSSPIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQPPPEPPTPAPAPPSSGGGSTPDDRVPRPPSPPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 11,971.344 | ||
| Theoretical pI: | 5.631 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 112.021 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.649 | ||
Secondary Structure Fraction | |||
| Helix | 0.184 | ||
| turn | 0.518 | ||
| sheet | 0.158 | ||