| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339704.1 | complete | 119 | 57-416(+) |
Amino Acid sequence : | |||
| MVEKGARKEEVISREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTTDVRVDVKLNKHIWSRGVRSVPRRIRVRIARKRNDDEDAKEELYSLVTVAEIPESGLKGLGTTVVDDEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,669.665 | ||
| Theoretical pI: | 9.849 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.387 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.151 | ||
| sheet | 0.244 | ||