Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339704.1 | complete | 119 | 57-416(+) |
Amino Acid sequence : | |||
MVEKGARKEEVISREYTINLHKRLHGCTFKKKAPKAIKEIRKFAQKAMGTTDVRVDVKLNKHIWSRGVRSVPRRIRVRIARKRNDDEDAKEELYSLVTVAEIPESGLKGLGTTVVDDEE* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,669.665 | ||
Theoretical pI: | 9.849 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 45.387 | ||
aromaticity | 0.042 | ||
GRAVY | -0.738 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.151 | ||
sheet | 0.244 |