| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339709.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| KLLWNTVKNFLDPKTVAKIHVLGYKYQNKLLEIIDASELPEFLGGTCTCADQGGCLSSDKGPWKNPEILKMVLNGEARRAKQIVKIISSDGKVVYAKPHYPMLKGSDTSTAESGSEAEDI ASPKANRSFSQIRLTPVREEARTVGTTGQFGNFSGYDEYVPMVDKVVDSGWKKQTIAEKFYVTEGTLPEPQKATVGFRAHVLAALMTFFMTLILYFRSIPFHIQKKLPNVSRQQEQIVAS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,707.426 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 43.547 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.229 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339709.1 | internal | 240 | 3-722(+) |
Amino Acid sequence : | |||
| KLLWNTVKNFLDPKTVAKIHVLGYKYQNKLLEIIDASELPEFLGGTCTCADQGGCLSSDKGPWKNPEILKMVLNGEARRAKQIVKIISSDGKVVYAKPHYPMLKGSDTSTAESGSEAEDI ASPKANRSFSQIRLTPVREEARTVGTTGQFGNFSGYDEYVPMVDKVVDSGWKKQTIAEKFYVTEGTLPEPQKATVGFRAHVLAALMTFFMTLILYFRSIPFHIQKKLPNVSRQQEQIVAS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 26,707.426 | ||
| Theoretical pI: | 9.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
| Instability index: | 43.547 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.229 | ||
| sheet | 0.233 | ||