Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339710.1 | complete | 202 | 75-683(+) |
Amino Acid sequence : | |||
MELTSKVREELYFQNYMTDENAPGGKPVMQPSREKPQRRRPGPDNRMNDDRGNRRDRDNRANDNEHFDRSDNAKSGDFNNSDGAAGNNPDEPMFDSFGQGIPVAAFPSDIPPPVLMPVPG AGPLGPFVPAPPEVAMQMLRDQGGPSPFEGGRNGRSGHQLGGGPSPIIALPPALRQDPRRLRSYNDLDAPDDEVTVIDYRSL* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,145.152 | ||
Theoretical pI: | 4.910 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 66.801 | ||
aromaticity | 0.059 | ||
GRAVY | -1.030 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.376 | ||
sheet | 0.208 |