| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339727.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| CHAEGSIAFVKKKKISELIKTFPAAANCLKTIVSFGKANPQQKEEAEKYGVAMYSWDEILSLGADKHFELPKKKKTDICTIMYTSGTTGRSQRSLDFQQQHCHFNSWG* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,158.803 | ||
| Theoretical pI: | 9.083 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 43.234 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.204 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339727.1 | 5prime_partial | 108 | 2-328(+) |
Amino Acid sequence : | |||
| CHAEGSIAFVKKKKISELIKTFPAAANCLKTIVSFGKANPQQKEEAEKYGVAMYSWDEILSLGADKHFELPKKKKTDICTIMYTSGTTGRSQRSLDFQQQHCHFNSWG* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,158.803 | ||
| Theoretical pI: | 9.083 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 43.234 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.538 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.204 | ||
| sheet | 0.222 | ||