Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339742.1 | 3prime_partial | 203 | 64-672(+) |
Amino Acid sequence : | |||
MRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAPLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIR TLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKD | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,732.866 | ||
Theoretical pI: | 5.467 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 40.100 | ||
aromaticity | 0.094 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.207 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339742.1 | 3prime_partial | 203 | 64-672(+) |
Amino Acid sequence : | |||
MRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAPLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIR TLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKD | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 22,732.866 | ||
Theoretical pI: | 5.467 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
Instability index: | 40.100 | ||
aromaticity | 0.094 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.207 | ||
sheet | 0.271 |