Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339753.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
APFSPPPPPPPSNSLLVIMPESLPSFSTSVKLKYVKQGYQYLVNHILTFTLLPIIVAVAVQLLRLGPHEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTC RVPFSTFMEHSRLILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSSIDSLMQKTGIRPKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNIKSFNLSGM GCSAGLISIDLARDLLQVHPNSHALVIS | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 15,916.594 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 82.484 | ||
aromaticity | 0.029 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.261 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339753.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
TIFSTTTTTPLKFTPRHHAGIPPQFLHLRQAQVCQARLPIPCQPHPHLHSPPHHRRRRRPAPPIRPPRNARHLELPPIGRPPPPLLLLPRRLRRHRLLHVQAEVDLPRGLRLLQAACHVP RPLLHLHGAFPPHSQRQP* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,916.594 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 82.484 | ||
aromaticity | 0.029 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.261 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339753.1 | internal | 268 | 1-804(+) |
Amino Acid sequence : | |||
APFSPPPPPPPSNSLLVIMPESLPSFSTSVKLKYVKQGYQYLVNHILTFTLLPIIVAVAVQLLRLGPHEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTC RVPFSTFMEHSRLILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSSIDSLMQKTGIRPKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNIKSFNLSGM GCSAGLISIDLARDLLQVHPNSHALVIS | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 15,916.594 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 82.484 | ||
aromaticity | 0.029 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.261 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339753.1 | 5prime_partial | 138 | 3-419(+) |
Amino Acid sequence : | |||
TIFSTTTTTPLKFTPRHHAGIPPQFLHLRQAQVCQARLPIPCQPHPHLHSPPHHRRRRRPAPPIRPPRNARHLELPPIGRPPPPLLLLPRRLRRHRLLHVQAEVDLPRGLRLLQAACHVP RPLLHLHGAFPPHSQRQP* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,916.594 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 82.484 | ||
aromaticity | 0.029 | ||
GRAVY | -0.664 | ||
Secondary Structure Fraction | |||
Helix | 0.246 | ||
turn | 0.261 | ||
sheet | 0.232 |