| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339756.1 | complete | 209 | 11-640(+) |
Amino Acid sequence : | |||
| MISLKFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYD VSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,048.039 | ||
| Theoretical pI: | 8.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27805 | ||
| Instability index: | 40.262 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.254 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339756.1 | complete | 209 | 11-640(+) |
Amino Acid sequence : | |||
| MISLKFISTLLPFLLLLLHAATAIRFDIQNKCSYTIWPAVLPHGGGRRLDSGQTWTLSFQNGPKLAKVWARTNCTFDSSGKGKCLTGDCGGQLNCTTFGSPPHTKAEYGLNDFGRKDYYD VSVLDGYNLPMEMTPTANGCTRSVKCAAEDIVANCPSQLKVDGGCQNPCTVFKTTEYCCHAGECRPTDMSRFFKSRCRDAFTYPQDDPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 23,048.039 | ||
| Theoretical pI: | 8.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27805 | ||
| Instability index: | 40.262 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.254 | ||
| turn | 0.254 | ||
| sheet | 0.191 | ||