Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339758.1 | complete | 108 | 91-417(+) |
Amino Acid sequence : | |||
MAKYAAIVLAIMVCVVLAESAPCDDVYKNLSPCRPALKQGGTPTASCCNGMKTLNSAATTKAARKSACECAKKLASSYKVNGQTASELVKKCKVDIGFTISNNVDCNK* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,297.162 | ||
Theoretical pI: | 9.123 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4970 | ||
Instability index: | 33.131 | ||
aromaticity | 0.037 | ||
GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
Helix | 0.222 | ||
turn | 0.231 | ||
sheet | 0.269 |