| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339762.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| TSANRKHETLYACNPFTRQCVELASPNQTVDYPSIVTHGFGVTKTSHEFKIVRIFQEREIDPRTGACVGIPNSNCQIYTLGTGKWRTAAAASGGAAYDSRLIGVFFKFNLHWLVQDFTGD ELISCFDLENETFTPFPPPFPGKKLLGSLGVLDDCLCLCDNTSSFEVDIWVMKEYGVGKSWGKKFVIRKMPELIGPSFEIVRVLKVLGDGNILLVWADYCVLNYCSKSE | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 12,711.258 | ||
| Theoretical pI: | 10.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 62.190 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.400 | ||
| sheet | 0.096 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339762.1 | complete | 115 | 637-290(-) |
Amino Acid sequence : | |||
| MLPSPKTFKTRTISNEGPISSGIFLITNFFPHDFPTPYSFITQISTSNDDVLSHKQRQSSSTPRLPSSFLPGNGGGKGVNVSFSRSKHEISSSPVKSCTSQWRLNLKKTPIRRLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,711.258 | ||
| Theoretical pI: | 10.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 62.190 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.400 | ||
| sheet | 0.096 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339762.1 | internal | 229 | 3-689(+) |
Amino Acid sequence : | |||
| TSANRKHETLYACNPFTRQCVELASPNQTVDYPSIVTHGFGVTKTSHEFKIVRIFQEREIDPRTGACVGIPNSNCQIYTLGTGKWRTAAAASGGAAYDSRLIGVFFKFNLHWLVQDFTGD ELISCFDLENETFTPFPPPFPGKKLLGSLGVLDDCLCLCDNTSSFEVDIWVMKEYGVGKSWGKKFVIRKMPELIGPSFEIVRVLKVLGDGNILLVWADYCVLNYCSKSE | |||
Physicochemical properties | |||
| Number of amino acids: | 229 | ||
| Molecular weight: | 12,711.258 | ||
| Theoretical pI: | 10.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 62.190 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.400 | ||
| sheet | 0.096 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339762.1 | complete | 115 | 637-290(-) |
Amino Acid sequence : | |||
| MLPSPKTFKTRTISNEGPISSGIFLITNFFPHDFPTPYSFITQISTSNDDVLSHKQRQSSSTPRLPSSFLPGNGGGKGVNVSFSRSKHEISSSPVKSCTSQWRLNLKKTPIRRLS* | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,711.258 | ||
| Theoretical pI: | 10.751 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 62.190 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
| Helix | 0.261 | ||
| turn | 0.400 | ||
| sheet | 0.096 | ||