| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339771.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| APVVLIQSSPLKMTNMFASAAPISTNNTTVEDMRRSVTYHPSVWKDHFLNYASPVTEVEMEQLEKQKERIKTLLAQTPDDSVLKVKLIDAIQRLGVGYHFEKEINRSLQQIHDTFQISSK DNDVHAVALSFRLLRQQGYPVPSDVFKKFIDDQGKLEELVMNDVDGMLSLYEASNYGMEGEDILDKALEISSSHLEPLASHSRRINEALEMPISKTLARLGARKFISIYEEDESHDEDLL NFAKLDFNILQ | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,568.047 | ||
| Theoretical pI: | 5.060 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 48.320 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.207 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339771.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
| APVVLIQSSPLKMTNMFASAAPISTNNTTVEDMRRSVTYHPSVWKDHFLNYASPVTEVEMEQLEKQKERIKTLLAQTPDDSVLKVKLIDAIQRLGVGYHFEKEINRSLQQIHDTFQISSK DNDVHAVALSFRLLRQQGYPVPSDVFKKFIDDQGKLEELVMNDVDGMLSLYEASNYGMEGEDILDKALEISSSHLEPLASHSRRINEALEMPISKTLARLGARKFISIYEEDESHDEDLL NFAKLDFNILQ | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,568.047 | ||
| Theoretical pI: | 5.060 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 48.320 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.207 | ||
| sheet | 0.291 | ||