Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339771.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
APVVLIQSSPLKMTNMFASAAPISTNNTTVEDMRRSVTYHPSVWKDHFLNYASPVTEVEMEQLEKQKERIKTLLAQTPDDSVLKVKLIDAIQRLGVGYHFEKEINRSLQQIHDTFQISSK DNDVHAVALSFRLLRQQGYPVPSDVFKKFIDDQGKLEELVMNDVDGMLSLYEASNYGMEGEDILDKALEISSSHLEPLASHSRRINEALEMPISKTLARLGARKFISIYEEDESHDEDLL NFAKLDFNILQ | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 28,568.047 | ||
Theoretical pI: | 5.060 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 48.320 | ||
aromaticity | 0.072 | ||
GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.207 | ||
sheet | 0.291 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339771.1 | internal | 251 | 1-753(+) |
Amino Acid sequence : | |||
APVVLIQSSPLKMTNMFASAAPISTNNTTVEDMRRSVTYHPSVWKDHFLNYASPVTEVEMEQLEKQKERIKTLLAQTPDDSVLKVKLIDAIQRLGVGYHFEKEINRSLQQIHDTFQISSK DNDVHAVALSFRLLRQQGYPVPSDVFKKFIDDQGKLEELVMNDVDGMLSLYEASNYGMEGEDILDKALEISSSHLEPLASHSRRINEALEMPISKTLARLGARKFISIYEEDESHDEDLL NFAKLDFNILQ | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 28,568.047 | ||
Theoretical pI: | 5.060 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 48.320 | ||
aromaticity | 0.072 | ||
GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.207 | ||
sheet | 0.291 |