| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339776.1 | 3prime_partial | 214 | 75-716(+) |
Amino Acid sequence : | |||
| MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASKVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVD AAANGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGG | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 22,675.452 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 31.326 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.285 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339776.1 | 3prime_partial | 214 | 75-716(+) |
Amino Acid sequence : | |||
| MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASKVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVD AAANGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGG | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 22,675.452 | ||
| Theoretical pI: | 5.061 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17420 | ||
| Instability index: | 31.326 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.285 | ||
| sheet | 0.285 | ||