| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339783.1 | 5prime_partial | 181 | 575-30(-) |
Amino Acid sequence : | |||
| EKEADNHGDCERLAKAFLQELNTFEIPLLKSKAVIDANIRERENFIELKDEINRQIVLAQDDIEDLKKQLEESKIERKHKEECEAIRKLIAMQPPRSETQKAITELEQEIASLELENTAS SRTLELRKKQFSLLLHLVDELQNPIEEEERSLIEEMRAMADEPRSGLLEDASGGPEAMALD* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 15,380.774 | ||
| Theoretical pI: | 8.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6125 | ||
| Instability index: | 54.395 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.748 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.347 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339783.1 | 3prime_partial | 144 | 142-573(+) |
Amino Acid sequence : | |||
| MGFCNSSTKCNRSENCFLRSSRVLELAVFSNSRDAISCSSSVMAFCVSDLGGCIAINFLIASHSSLCFLSILLSSSCFFKSSISSCARTICLFISSFNSIKFSLSLIFASITALLFSSGI SKVFSSCKKALASLSQSPWLSASF | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,380.774 | ||
| Theoretical pI: | 8.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6125 | ||
| Instability index: | 54.395 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.748 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.347 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339783.1 | 5prime_partial | 181 | 575-30(-) |
Amino Acid sequence : | |||
| EKEADNHGDCERLAKAFLQELNTFEIPLLKSKAVIDANIRERENFIELKDEINRQIVLAQDDIEDLKKQLEESKIERKHKEECEAIRKLIAMQPPRSETQKAITELEQEIASLELENTAS SRTLELRKKQFSLLLHLVDELQNPIEEEERSLIEEMRAMADEPRSGLLEDASGGPEAMALD* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 15,380.774 | ||
| Theoretical pI: | 8.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6125 | ||
| Instability index: | 54.395 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.748 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.347 | ||
| sheet | 0.222 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339783.1 | 3prime_partial | 144 | 142-573(+) |
Amino Acid sequence : | |||
| MGFCNSSTKCNRSENCFLRSSRVLELAVFSNSRDAISCSSSVMAFCVSDLGGCIAINFLIASHSSLCFLSILLSSSCFFKSSISSCARTICLFISSFNSIKFSLSLIFASITALLFSSGI SKVFSSCKKALASLSQSPWLSASF | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 15,380.774 | ||
| Theoretical pI: | 8.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 6125 | ||
| Instability index: | 54.395 | ||
| aromaticity | 0.111 | ||
| GRAVY | 0.748 | ||
Secondary Structure Fraction | |||
| Helix | 0.347 | ||
| turn | 0.347 | ||
| sheet | 0.222 | ||