Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339793.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
APVAYPVLIIAEDIDLETLGTLVVNKLRGALKVAALKAPGFGERKSQYLDDIATLTGGTVIREEVGLTLDKADKEVLGHAAKVVLTKDSTTIVGDGSTQDAVNKRVAQIRNLIEQAAEQD YEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLENDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKY G | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 25,512.919 | ||
Theoretical pI: | 5.497 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 24.899 | ||
aromaticity | 0.025 | ||
GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.187 | ||
sheet | 0.320 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339793.1 | internal | 241 | 1-723(+) |
Amino Acid sequence : | |||
APVAYPVLIIAEDIDLETLGTLVVNKLRGALKVAALKAPGFGERKSQYLDDIATLTGGTVIREEVGLTLDKADKEVLGHAAKVVLTKDSTTIVGDGSTQDAVNKRVAQIRNLIEQAAEQD YEKEKLNERIAKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAIKATLENDEEKVGADIVKRALSYPLKLIAKNAGVNGSVVSEKVLSSDNPKY G | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 25,512.919 | ||
Theoretical pI: | 5.497 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 24.899 | ||
aromaticity | 0.025 | ||
GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.187 | ||
sheet | 0.320 |