Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339813.1 | 5prime_partial | 190 | 3-575(+) |
Amino Acid sequence : | |||
TISSFSGPLNLPNRASANSLSAPIKSSGGFKESLDDKSKTNLVQIKGRFSVTSENVDLVKDIPLSTVSRRNSQGSPLRKSASVGNWIFDSKQMPQSQPSKESGNTNALASVLMPHLQNLF QQTSIQQDIIMNLLTNLQTVEVENAPQNGKLPPLPRGSDTNGSVSTSVDNCSFWWLYFLFEETVEGIWRK* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 20,843.149 | ||
Theoretical pI: | 8.756 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
Instability index: | 39.400 | ||
aromaticity | 0.068 | ||
GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.358 | ||
sheet | 0.195 |