| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY339813.1 | 5prime_partial | 190 | 3-575(+) |
Amino Acid sequence : | |||
| TISSFSGPLNLPNRASANSLSAPIKSSGGFKESLDDKSKTNLVQIKGRFSVTSENVDLVKDIPLSTVSRRNSQGSPLRKSASVGNWIFDSKQMPQSQPSKESGNTNALASVLMPHLQNLF QQTSIQQDIIMNLLTNLQTVEVENAPQNGKLPPLPRGSDTNGSVSTSVDNCSFWWLYFLFEETVEGIWRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 20,843.149 | ||
| Theoretical pI: | 8.756 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
| Instability index: | 39.400 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.358 | ||
| sheet | 0.195 | ||