Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339816.1	5prime_partial	125	3-380(+)
Amino Acid sequence :
TTQIHTHMCSFNFNDIIHSIINMDADVITIENSRSDEKLLSVFREGVKYGAGIGPGVYDIHSPRIPSTEEIADRINKMLAVLESNILWVNPDCGLKTRKYGEVKPALENMDAAAKLLRSQ LASAK*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		12,487.632
Theoretical pI:		9.357
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26470
Instability index:		54.482
aromaticity		0.118
GRAVY		0.285
Secondary Structure Fraction
Helix		0.345
turn		0.273
sheet		0.273

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY339816.1	3prime_partial	110	331-2(-)
Amino Acid sequence :
MFSRAGFTSPYLRVLRPQSGFTHKMLLSRTASILLILSAISSVDGILGEWMSYTPGPIPAPYFTPSRKTDSSFSSEREFSIVITSASMLMMEWMMSLKLKEHMCVWIWVV
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,487.632
Theoretical pI:		9.357
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26470
Instability index:		54.482
aromaticity		0.118
GRAVY		0.285
Secondary Structure Fraction
Helix		0.345
turn		0.273
sheet		0.273