Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339824.1 | internal | 231 | 1-693(+) |
Amino Acid sequence : | |||
APVYMLMSISMQFISCVQLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWG VERALRIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSII | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 26,407.121 | ||
Theoretical pI: | 8.991 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
Instability index: | 52.269 | ||
aromaticity | 0.091 | ||
GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.221 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY339824.1 | internal | 231 | 1-693(+) |
Amino Acid sequence : | |||
APVYMLMSISMQFISCVQLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWG VERALRIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSII | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 26,407.121 | ||
Theoretical pI: | 8.991 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
Instability index: | 52.269 | ||
aromaticity | 0.091 | ||
GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.221 | ||
sheet | 0.229 |